PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g65238.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 368aa    MW: 39242.2 Da    PI: 6.6347
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g65238.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.4e-1663110148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g WT+eEd +l+ +   +G+g+W++++++ g++R++k+c++r+ +yl
  Bradi1g65238.2.p  63 KGLWTPEEDAKLLAYTSNHGTGNWTSVPQRAGLKRCGKSCRLRYTNYL 110
                       678*******************************************97 PP

2Myb_DNA-binding52.61e-16118159346
                       SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       ++T+eE+el+v ++++lG++ W++Ia+ ++ gRt++++k++w++
  Bradi1g65238.2.p 118 SFTQEEEELIVTLHAMLGSR-WSLIANQLP-GRTDNDVKNYWNT 159
                       79******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.0E-2454114IPR009057Homeodomain-like
PROSITE profilePS5129416.79458110IPR017930Myb domain
SuperFamilySSF466893.18E-2960157IPR009057Homeodomain-like
SMARTSM007177.6E-1362112IPR001005SANT/Myb domain
PfamPF002496.4E-1563110IPR001005SANT/Myb domain
CDDcd001674.81E-1066110No hitNo description
PROSITE profilePS5129425.04111165IPR017930Myb domain
SMARTSM007174.9E-15115163IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.0E-23115165IPR009057Homeodomain-like
CDDcd001676.23E-12118161No hitNo description
PfamPF002495.0E-15118159IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MLLPCVHFSR FSPYMYYHYH PRSDLAGQGG TGVWCLVLDR KGEETRRGSM GRPPCCDKAN  60
VKKGLWTPEE DAKLLAYTSN HGTGNWTSVP QRAGLKRCGK SCRLRYTNYL RPNLKHESFT  120
QEEEELIVTL HAMLGSRWSL IANQLPGRTD NDVKNYWNTK LSKKLRQRGI DPLTHRPIAD  180
LMQSIGTLAI RPPPAAAASS SSPYFPINNP AAPPPLPLLQ DDDVSYHAAL QQKQEVITLL  240
DADAPGAAAS PDHHHHQQLK WSDFLADDAA AALEAAAPPA QFQEAAAVAG GGGLSARACG  300
GDIGGGVGIG GGGAGDDGAA SSAFIDAMLD SDRKMGVDQL IAELLADPAY CYGACCGSSS  360
SEMGWGC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27631657108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3727360.0AK372736.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3010N13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558134.10.0PREDICTED: myb-related protein Zm38-like
TrEMBLA0A0Q3LGD40.0A0A0Q3LGD4_BRADI; Uncharacterized protein
STRINGOB03G23760.11e-142(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118743439
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.19e-66myb domain protein 103